PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 360aa    MW: 40446.1 Da    PI: 6.7146
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-41207PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-164589147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
        Lsa016517 45 RERWTEEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 89
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-173993IPR009057Homeodomain-like
PROSITE profilePS5129421.4764094IPR017930Myb domain
TIGRFAMsTIGR015573.8E-174392IPR006447Myb domain, plants
SMARTSM007172.5E-134492IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-104585IPR009057Homeodomain-like
PfamPF002493.8E-144588IPR001005SANT/Myb domain
CDDcd001671.57E-104790No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MVCESMAEDR SEEGSDSNTN KNDQFTSQDD YAPKVRKPYT ITKQRERWTE EEHKKFLEAL  60
KLYGRAWRRI EEHVGTKTAV QIRSHAQKFF SKVVRESTGD VSEVKPIEIP PPRPKRKPMH  120
PYPRKLSAPI KTGGHGQHAR ATSPNSSGSD QENQSPTSVL SAGGSNVFGL GDSGSPNTES  180
SPEENESPPP MKMESCSEEK DFGSTQSLKL FGKTVVITDS NQNEEKNTTM PISSLPCGAP  240
VYYMQFLDEN MESTVVRSSP SVTPWWGVYG HVSSYPLGQQ LCNPVNMEGC SDSESVGGKD  300
EEEDDYENEK KKKKPFLLIG SERSAFTKQH SKKKDTCMKG FVPYKRCVEE REEQRIRLCL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790907.13e-77PREDICTED: protein REVEILLE 1-like isoform X1
RefseqXP_002267976.23e-77PREDICTED: protein REVEILLE 1
TrEMBLA0A103Y5S61e-164A0A103Y5S6_CYNCS; Homeodomain-like protein
STRINGVIT_04s0079g00410.t016e-78(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-53MYB_related family protein